discontinued

H00009180-B01P OSMR antibody

See related secondary antibodies

Search for all "OSMR"

Quick Overview

Mouse anti Human OSMR

Product Description for OSMR

Mouse anti Human OSMR.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for OSMR

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms IL-31 receptor beta, IL-31R-beta, IL-31RB, Interleukin-31 receptor subunit beta, OSMRB, Oncostatin-M receptor beta, Oncostatin-M specific receptor subunit beta
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99650
Immunogen:
OSMR (AAH10943, 1 a.a. ~ 342 a.a) full-length human protein.
AA Sequence:
MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIET SNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVF PKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKG IVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQE TYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH
GeneID:
9180
Remarks:
Gene Accession: BC010943
Add. information Mouse polyclonal antibody raised against a full-length human OSMR protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 9180

Accessory Products

Proteins and/or Positive Controls

Proteins for OSMR (6 products)

Catalog No. Species Pres. Purity   Source  

OSMR (transcript variant 2)

OSMR Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

OSMR (transcript variant 1)

OSMR Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €139.00
  OriGene Technologies, Inc.

OSMR

OSMR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OSMR

OSMR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OSMR

OSMR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

OSMR

OSMR Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for OSMR (1 products)

Catalog No. Species Pres. Purity   Source  

OSMR 293T Cell Transient Overexpression Lysate(Denatured)

OSMR 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn