discontinued

NBP1-91108 OSTB antibody

See related secondary antibodies

Search for all "OSTB"

Quick Overview

Rabbit anti Human OSTB

Product Description for OSTB

Rabbit anti Human OSTB.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for OSTB

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UW2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETE
GeneID:
123264
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 123264

Accessory Products

Proteins and/or Positive Controls

Proteins for OSTB (3 products)

Catalog No. Species Pres. Purity   Source  

Organic solute transporter beta (OSTbeta)

Organic solute transporter beta (OSTbeta) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

SLC51B (57-128, His-tag)

SLC51B Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €730.00
  Acris Antibodies GmbH

SLC51B (57-128, His-tag)

SLC51B Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €300.00
  Acris Antibodies GmbH

Positive controls for OSTB (1 products)

Catalog No. Species Pres. Purity   Source  

SLC51B overexpression lysate

SLC51B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn