NBP1-91108 OSTB antibody

See related secondary antibodies

Search for all "OSTB"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human OSTB

Product Description for OSTB

Rabbit anti Human OSTB.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for OSTB

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UW2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETE
GeneID:
123264
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 123264

Accessory Products

Proteins and/or Positive Controls

Proteins for OSTB (3 products)

Catalog No. Species Pres. Purity   Source  

Organic solute transporter beta (OSTbeta)

Organic solute transporter beta (OSTbeta) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

SLC51B (57-128, His-tag)

SLC51B Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €730.00
  Acris Antibodies GmbH

SLC51B (57-128, His-tag)

SLC51B Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €300.00
  Acris Antibodies GmbH

Positive controls for OSTB (1 products)

Catalog No. Species Pres. Purity   Source  

SLC51B overexpression lysate

SLC51B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn