NBP1-90485 OTUD3 antibody

See related secondary antibodies

Search for all "OTUD3"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human OTUD3

NBP1-90485

More Views

  • NBP1-90485

Product Description for OTUD3

Rabbit anti Human OTUD3.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for OTUD3

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T2D3
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP
GeneID:
23252
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 23252

Accessory Products

Proteins and/or Positive Controls

Proteins for OTUD3 (1 products)

Catalog No. Species Pres. Purity   Source  

OTU domain containing 3 (OTUD3)

OTU domain containing 3 (OTUD3) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for OTUD3 (1 products)

Catalog No. Species Pres. Purity   Source  

OTUD3 overexpression lysate

OTUD3 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn