TA331666 OXNAD1 antibody

Rabbit Polyclonal Anti-OXNAD1 Antibody

See related secondary antibodies

Search for all "OXNAD1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human OXNAD1

Product Description for OXNAD1

Rabbit anti Guinea Pig, Human OXNAD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OXNAD1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Oxidoreductase NAD-binding domain-containing protein 1
Presentation Purified
Reactivity GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-OXNAD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OXNAD1. Synthetic peptide located within the following region: ILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFP.
Application WB
Background The function of this protein remains unknown.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for OXNAD1 (3 products)

Catalog No. Species Pres. Purity   Source  


OXNAD1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


OXNAD1 Human Purified
  Abnova Taiwan Corp.


OXNAD1 Human Purified
  Abnova Taiwan Corp.

Positive controls for OXNAD1 (1 products)

Catalog No. Species Pres. Purity   Source  

OXNAD1 Lysate

Western Blot: OXNAD1 Lysate [NBL1-14022] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for OXNAD1
  Novus Biologicals Inc.
  • LinkedIn