H00728773-B01 PABPCP2 antibody

See related secondary antibodies

Search for all "PABPCP2"

50 µl / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human PABPCP2

Product Description for PABPCP2

Mouse anti Human PABPCP2.
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for PABPCP2

Product Category Primary Antibodies
Quantity 50 µl
Synonyms PABP2, cytoplasmic, poly binding protein, pseudogene 2
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
PABPCP2 (AAH68242, 1 a.a. ~ 269 a.a) full-length human protein.
AA Sequence:
MDGMLLNGLNVFVGRFRSPKEQEAELGARAKESKVGPASSVKVITDEGGKSKGFGFVSFERHEDPQTAMDVNGKEF SGNQTYICLAPKKVEEQTELKCKFEQMKQDRITRYQGANVCVKNLDESIDDERLQKEFSPFGIINSANVMMEGGCS KRFGFVCFSSPEEVAKAVTAMNGKIVASKPLHVALAQCKEQRLAHFTNQYMQKMASVRAVPHPVINPYQPAPSTCY FVAAIPQTQNRAAYYPPGQIAQLRPSPPWAVQSVRPYPFQI
Remarks:
Gene Accession: BC068242
Add. information Mouse polyclonal antibody raised against a full-length human PABPCP2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
Specificity
Species:
Human

Accessory Products

  • LinkedIn