discontinued

H00026979-B01 PABPCP2 MaxPab mouse MaxPab antibody

See related secondary antibodies

Search for all "PABPCP2 MaxPab mouse"

50 µl / €370.00

Quick Overview

Mouse anti Human PABPCP2 MaxPab mouse

H00026979-B01

Product Description for PABPCP2 MaxPab mouse

Mouse anti Human PABPCP2 MaxPab mouse.
Properties: MaxPab
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for PABPCP2 MaxPab mouse

Product Category Primary Antibodies
Quantity 50 µl
Synonyms A, PABP2, cytoplasmic, poly binding protein, pseudogene 2
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
PABPCP2 (AAH68242, 1 a.a. ~ 269 a.a) full-length human protein.
AA Sequence:
MDGMLLNGLNVFVGRFRSPKEQEAELGARAKESKVGPASSVKVITDEGGKSKGFGFVSFERHEDPQTAMDVNGKEF SGNQTYICLAPKKVEEQTELKCKFEQMKQDRITRYQGANVCVKNLDESIDDERLQKEFSPFGIINSANVMMEGGCS KRFGFVCFSSPEEVAKAVTAMNGKIVASKPLHVALAQCKEQRLAHFTNQYMQKMASVRAVPHPVINPYQPAPSTCY FVAAIPQTQNRAAYYPPGQIAQLRPSPPWAVQSVRPYPFQI
Remarks:
Gene Accession: BC068242
Property MaxPab
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
None
State:
Purified

Accessory Products

  • LinkedIn