
NBP1-74221 PAK4 antibody

See related secondary antibodies

Search for all "PAK4"

Quick Overview

Rabbit anti Rat PAK4


Product Description for PAK4

Rabbit anti Rat PAK4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PAK4

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the N terminal of Pak4. Immunizing peptide sequence TGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTIVR.
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified
Gene ID 292756

Accessory Products

  • LinkedIn