discontinued

NBP1-69318 PAM antibody

See related secondary antibodies

Search for all "PAM"

50 µg / €440.00

Quick Overview

Rabbit anti Human PAM

Product Description for PAM

Rabbit anti Human PAM.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PAM

Product Category Primary Antibodies
Quantity 50 µg
Synonyms PAL
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NMR0
Immunogen:
Synthetic peptides corresponding to PAM(peptidylglycine alpha-amidating monooxygenase) The peptide sequence was selected from the N terminal of PAM. Peptide sequence PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL.
GeneID:
5066
Background PAM is a multifunctional protein. It has two enzymatically active domains with catalytic activities-peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products.This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 5066

Accessory Products

  • LinkedIn