discontinued

H00011044-B01 PAPD7 / POLS / TRF4 antibody

See related secondary antibodies

Search for all "PAPD7 / POLS / TRF4"

Quick Overview

Mouse anti Human PAPD7 / POLS / TRF4

Product Description for PAPD7 / POLS / TRF4

Mouse anti Human PAPD7 / POLS / TRF4.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for PAPD7 / POLS / TRF4

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms DNA polymerase kappa, DNA polymerase sigma, LAK-1, PAP-associated domain-containing protein 7, TRF-4, TUTase5, Terminal uridylyltransferase 5, Topoisomerase-related function protein 4-1
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5XG87
Immunogen:
POLS (NP_008930.1, 1 a.a. ~ 542 a.a) full-length human protein.
AA Sequence:
MSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEP CSIKVLDKATVPIIKLTDQETEVKVDISFNMETGVRAAEFIKNYMKKYSLLPYLILVLKQFLLQRDLNEVFTGGIS SYSLILMAISFLQLHPRIDARRADENLGMLLVEFFELYGRNFNYLKTGIRIKEGGAYIAKEEIMKAMTSGYRPSML CIEDPLLPGNDVGRSSYGAMQVKQVFDYAYIVLSHAVSPLARSYPNRDAESTLGRIIKVTQEVIDYRRWIKEKWGS KAHPSPGMDSRIKIKERIATCNGEQTQNREPESPYGQRLTLSLSSPQLLSSGSSASSVSSLSGSDVDSDTPPCTTP SVYQFSLQAPAPLMAGLPTALPMPSGKPQPTTSRTLIMTTNNQTRFTIPPPTLGVAPVPCRQAGVEGTASLKAVHH MSSPAIPSASPNPLSSPHLYHKQHNGMKLSMKGSHGHTQGGGYSSVGSGGVRPPVGNRGHHQYNRTGWRRKKHTHT RDSLPVSLSR
GeneID:
11044
Remarks:
Gene Accession: NM_006999
Add. information Mouse polyclonal antibody raised against a full-length human POLS protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 11044

Accessory Products

Proteins and/or Positive Controls

Proteins for PAPD7 / POLS / TRF4 (4 products)

Catalog No. Species Pres. Purity   Source  

PAPD7 / POLS / TRF4

PAPD7 / POLS / TRF4 Human Purified
  Abnova Taiwan Corp.

PAPD7 / POLS / TRF4

PAPD7 / POLS / TRF4 Human Purified
  Abnova Taiwan Corp.

PAPD7 / POLS / TRF4

PAPD7 / POLS / TRF4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PAPD7 / POLS / TRF4

PAPD7 / POLS / TRF4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PAPD7 / POLS / TRF4 (1 products)

Catalog No. Species Pres. Purity   Source  

POLS 293T Cell Transient Overexpression Lysate(Denatured)

POLS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn