discontinued

H00011044-M01 PAPD7 / POLS / TRF4 antibody

See related secondary antibodies

Search for all "PAPD7 / POLS / TRF4"

Quick Overview

Mouse anti Human PAPD7 / POLS / TRF4 2F8

H00011044-M01

More Views

  • H00011044-M01
  • H00011044-M01

Product Description for PAPD7 / POLS / TRF4

Mouse anti Human PAPD7 / POLS / TRF4 2F8.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for PAPD7 / POLS / TRF4

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DNA polymerase kappa, DNA polymerase sigma, LAK-1, PAP-associated domain-containing protein 7, TRF-4, TUTase5, Terminal uridylyltransferase 5, Topoisomerase-related function protein 4-1
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2F8
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5XG87
Immunogen:
POLS (NP_008930, 2 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPC SIKVLDKATVPIIKLTDQETEVKVDISFNMETG*
GeneID:
11044
Remarks:
Gene Accession: NM_006999
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant POLS.

Antibody Reactive Against Recombinant Protein.
Application ELISA,RNAi-Ab,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 11044

Accessory Products

Proteins and/or Positive Controls

Proteins for PAPD7 / POLS / TRF4 (4 products)

Catalog No. Species Pres. Purity   Source  

PAPD7 / POLS / TRF4

PAPD7 / POLS / TRF4 Human Purified
  Abnova Taiwan Corp.

PAPD7 / POLS / TRF4

PAPD7 / POLS / TRF4 Human Purified
  Abnova Taiwan Corp.

PAPD7 / POLS / TRF4

PAPD7 / POLS / TRF4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PAPD7 / POLS / TRF4

PAPD7 / POLS / TRF4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PAPD7 / POLS / TRF4 (1 products)

Catalog No. Species Pres. Purity   Source  

POLS 293T Cell Transient Overexpression Lysate(Denatured)

POLS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn