
NBP1-57560 PAPOLB antibody

See related secondary antibodies

Search for all "PAPOLB"

50 µg / €440.00

Quick Overview

Rabbit anti Human PAPOLB

Product Description for PAPOLB

Rabbit anti Human PAPOLB.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PAPOLB

Product Category Primary Antibodies
Quantity 50 µg
Synonyms PAPT
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PAPOLB(poly(A) polymerase beta (testis specific)) The peptide sequence was selected from the N terminal of PAPOLB. Peptide sequence TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK.
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 56903

Accessory Products

  • LinkedIn