discontinued

NBP1-58030 PAPP A2 antibody

See related secondary antibodies

Search for all "PAPP A2"

Quick Overview

Rabbit anti Human PAPP A2

Product Description for PAPP A2

Rabbit anti Human PAPP A2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PAPP A2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A9Z1Y8
Immunogen:
Synthetic peptides corresponding to PAPPA2(pappalysin 2) The peptide sequence was selected from the N terminal of PAPPA2. Peptide sequence PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL.
GeneID:
60676
Background PAPPA2 is a metalloproteinase which specifically cleaves IGFBP-5. It shows limited proteolysis toward IGFBP-3.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 60676

Accessory Products

  • LinkedIn