discontinued

NBP1-58030 PAPP A2 antibody

See related secondary antibodies

Search for all "PAPP A2"

50 µg / €390.00

Quick Overview

Rabbit anti Human PAPP A2

Product Description for PAPP A2

Rabbit anti Human PAPP A2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PAPP A2

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A9Z1Y8
Immunogen:
Synthetic peptides corresponding to PAPPA2(pappalysin 2) The peptide sequence was selected from the N terminal of PAPPA2. Peptide sequence PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL.
GeneID:
60676
Background PAPPA2 is a metalloproteinase which specifically cleaves IGFBP-5. It shows limited proteolysis toward IGFBP-3.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 60676

Accessory Products

  • LinkedIn