
NBP1-59477 PAQR6 antibody

See related secondary antibodies

Search for all "PAQR6"

Quick Overview

Rabbit anti Human, Mouse, Rat PAQR6

Product Description for PAQR6

Rabbit anti Human, Mouse, Rat PAQR6.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PAQR6

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PAQR6(progestin and adipoQ receptor family member VI) The peptide sequence was selected from the N terminal of PAQR6. Peptide sequence PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL.
Background This protein mediates receptor activity
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 79957

Accessory Products

  • LinkedIn