NBP1-54824 PAR6 antibody

See related secondary antibodies

Search for all "PAR6"

Quick Overview

Rabbit anti Human PAR6

Product Description for PAR6

Rabbit anti Human PAR6.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PAR6

Product Category Primary Antibodies
Quantity 50 µg
Synonyms PAR-6A, PAR6, PAR6C, PAR6alpha, TAX40, TIP-40
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PARD6A(par-6 partitioning defective 6 homolog alpha (C. elegans)) Antibody(against the N terminal of PARD6A. Peptide sequence MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH.
Background This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 56513

Accessory Products

  • LinkedIn