discontinued

NBP1-59129 PARVB antibody

See related secondary antibodies

Search for all "PARVB"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat PARVB

Product Description for PARVB

Rabbit anti Human, Mouse, Rat PARVB.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PARVB

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CGI-56
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96PN1
Immunogen:
Synthetic peptides corresponding to PARVB(parvin, beta) The peptide sequence was selected from the N terminal of PARVB. Peptide sequence LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELV.
GeneID:
29780
Background Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.[supplied by OMIM].
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 29780

Accessory Products

  • LinkedIn