NBP1-59135 PARVB antibody

See related secondary antibodies

Search for all "PARVB"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat PARVB

Product Description for PARVB

Rabbit anti Human, Mouse, Rat PARVB.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PARVB

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CGI-56
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96PN1
Immunogen:
Synthetic peptides corresponding to PARVB(parvin, beta) The peptide sequence was selected from the C terminal of PARVB. Peptide sequence HNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKYKNVE.
GeneID:
29780
Background Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.[supplied by OMIM].
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 29780

Accessory Products

  • LinkedIn