NBP1-69130 PAX7 antibody

See related secondary antibodies

Search for all "PAX7"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Rat PAX7

NBP1-69130

Product Description for PAX7

Rabbit anti Rat PAX7.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for PAX7

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4S8J0
Immunogen:
Synthetic peptides corresponding to Pax7 (paired box 7) The peptide sequence was selected from the middle region of Pax7. Peptide sequence SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ.
GeneID:
5005740
Background The function of Pax7 remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 5005740

Accessory Products

  • LinkedIn