discontinued

H00005090-A01 PBX3 antibody

See related secondary antibodies

Search for all "PBX3"

Quick Overview

Mouse anti Human PBX3

Product Description for PBX3

Mouse anti Human PBX3.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for PBX3

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Homeobox protein PBX3, Pre-B-cell leukemia transcription factor 3
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P40426
Immunogen:
PBX3 (NP_006186, 342 a.a. ~ 435 a.a) partial recombinant protein with GST tag.
AA Sequence:
FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSS VTSPTEGPGSVHSDTSN*
GeneID:
5090
Remarks:
Gene Accession: NM_006195
Add. information Mouse polyclonal antibody raised against a partial recombinant PBX3.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 5090

Accessory Products

Proteins and/or Positive Controls

Proteins for PBX3 (2 products)

Catalog No. Species Pres. Purity   Source  

PBX3

PBX3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PBX3

PBX3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PBX3 (1 products)

Catalog No. Species Pres. Purity   Source  

PBX3 overexpression lysate

PBX3 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn