discontinued

H00005090-M03 PBX3 antibody

See related secondary antibodies

Search for all "PBX3"

Quick Overview

Mouse anti Human PBX3 2E12

H00005090-M03

More Views

  • H00005090-M03

Product Description for PBX3

Mouse anti Human PBX3 2E12.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for PBX3

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Homeobox protein PBX3, Pre-B-cell leukemia transcription factor 3
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2E12
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P40426
Immunogen:
PBX3 (NP_006186, 342 a.a. ~ 435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSS VTSPTEGPGSVHSDTSN*
GeneID:
5090
Remarks:
Gene Accession: NM_006195
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant PBX3.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 5090

Accessory Products

Proteins and/or Positive Controls

Proteins for PBX3 (2 products)

Catalog No. Species Pres. Purity   Source  

PBX3

PBX3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PBX3

PBX3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PBX3 (1 products)

Catalog No. Species Pres. Purity   Source  

PBX3 overexpression lysate

PBX3 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn