TA343897 PCBP3 antibody

Rabbit Polyclonal Anti-PCBP3 Antibody

See related secondary antibodies

Search for all "PCBP3"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PCBP3

Product Description for PCBP3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish PCBP3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PCBP3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Alpha-CP3, Poly(rC)-binding protein 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P57721
Immunogen:
The immunogen for anti-PCBP3 antibody: synthetic peptide directed towards the middle region of human PCBP3. Synthetic peptide located within the following region: QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI.
GeneID:
54039
Application WB
Background This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to R with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptiol activities and h
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PCBP3 (3 products)

Catalog No. Species Pres. Purity   Source  

PCBP3 (transcript variant 1)

PCBP3 Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PCBP3

PCBP3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PCBP3

PCBP3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PCBP3 (2 products)

Catalog No. Species Pres. Purity   Source  

PCBP3 293T Cell Transient Overexpression Lysate(Denatured)

PCBP3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PCBP3 overexpression lysate

PCBP3 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn