discontinued

H00083259-A01 PCDH11Y antibody

See related secondary antibodies

Search for all "PCDH11Y"

Quick Overview

Mouse anti Human PCDH11Y

Product Description for PCDH11Y

Mouse anti Human PCDH11Y.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for PCDH11Y

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms PCDH-Y, PCDH11, PCDH22, PCDHY, Protocadherin 11, Protocadherin 22, Protocadherin prostate cancer, Protocadherin-11, Protocadherin-11 Y-linked, Protocadherin-22, Protocadherin-PC
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZA8
Immunogen:
PCDH11Y (-, 57 a.a. ~ 166 a.a) partial recombinant protein with GST tag.
AA Sequence:
EKNYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGI PRDEHCFYEVEVAILPDEIFRLVKIRFLIEDIN*
GeneID:
83259
Remarks:
Gene Accession: NM_032973
Add. information Mouse polyclonal antibody raised against a partial recombinant PCDH11Y.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 83259

Accessory Products

Proteins and/or Positive Controls

Proteins for PCDH11Y (2 products)

Catalog No. Species Pres. Purity   Source  

PCDH11Y

PCDH11Y Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PCDH11Y

PCDH11Y Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PCDH11Y (1 products)

Catalog No. Species Pres. Purity   Source  

PCDH11Y Lysate

Western Blot: PCDH11Y Lysate [NBL1-14149] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PCDH11Y
  Novus Biologicals Inc.
  • LinkedIn