TA334984 PCDH17 antibody

Rabbit Polyclonal Anti-PCDH17 Antibody

See related secondary antibodies

Search for all "PCDH17"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PCDH17

Product Description for PCDH17

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PCDH17.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PCDH17

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms PCDH68, PCH68, Protocadherin 17, Protocadherin 68, Protocadherin-17, Protocadherin-68
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-PCDH17 antibody: synthetic peptide directed towards the C terminal of human PCDH17. Synthetic peptide located within the following region: SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK.
Application WB
Background PCDH17 contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins.It may play a role in the establishment and function of specific cell-cell connections in the brain.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins. The encoded protein may play a role in the establishment and function of specific cell-cell connections in the brain. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-866 AL445288.9 90051-90916 867-4389 BC028165.1 1-3523 4390-8009 AL445216.6 89335-92954
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for PCDH17 (1 products)

Catalog No. Species Pres. Purity   Source  


PCDH17 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Positive controls for PCDH17 (2 products)

Catalog No. Species Pres. Purity   Source  

PCDH17 Lysate

PCDH17 Lysate
  Novus Biologicals Inc.

PCDH17 overexpression lysate

PCDH17 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn