
NBP1-59272 PCDH8 antibody

See related secondary antibodies

Search for all "PCDH8"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Mouse, Rat PCDH8

Product Description for PCDH8

Rabbit anti Human, Mouse, Rat PCDH8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PCDH8

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PCDH8(protocadherin 8) The peptide sequence was selected from the middle region of PCDH8. Peptide sequence GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG.
Background This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. PCDH8 is an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region. Alternative splicing yields isoforms with unique cytoplasmic tails.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 5100

Accessory Products

  • LinkedIn