NBP1-59272 PCDH8 antibody

See related secondary antibodies

Search for all "PCDH8"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat PCDH8

Product Description for PCDH8

Rabbit anti Human, Mouse, Rat PCDH8.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PCDH8

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TAN1
Immunogen:
Synthetic peptides corresponding to PCDH8(protocadherin 8) The peptide sequence was selected from the middle region of PCDH8. Peptide sequence GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG.
GeneID:
5100
Background This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. PCDH8 is an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region. Alternative splicing yields isoforms with unique cytoplasmic tails.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 5100

Accessory Products

  • LinkedIn