
NBP1-54812 PCNP antibody

See related secondary antibodies

Search for all "PCNP"

Quick Overview

Rabbit anti Human PCNP

Product Description for PCNP

Rabbit anti Human PCNP.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PCNP

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp781I24156
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PCNP(PEST proteolytic signal containing nuclear protein) The peptide sequence was selected from the middle region of PCNP. Peptide sequence AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD.
Background PCNP may be involved in cell cycle regulation.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 100172171

Accessory Products

  • LinkedIn