H00347862-B01P PDDC1 antibody

See related secondary antibodies

Search for all "PDDC1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human PDDC1

H00347862-B01P

Product Description for PDDC1

Mouse anti Human PDDC1.
Product is tested for Western blot / Immunoblot.

Properties for PDDC1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ34283, FLJ35497, MGC131881, MGC138350
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NB37
Immunogen:
PDDC1 (NP_872418.1, 1 a.a. ~ 220 a.a) full-length human protein.
AA Sequence:
MASERLPNRPACLLVASGAAEGVSAQSFLHCFTMASTAFNLQVATPGGKAMEFVDVTESNARWVQDFRLKAYASPA KLESIDGARYHALLIPSCPGALTDLASSGSLARILQHFHSESKPICAVGHGVAALCCATNEDRSWVFDSYSLTGPS VCELVRAPGFARLPLVVEDFVKDSGACFSASEPDAVHVVLDRHLVTGQNASSTVPAVQNLLFLCGSRK
GeneID:
347862
Add. information Mouse polyclonal antibody raised against a full-length human PDDC1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for PDDC1 (1 products)

Catalog No. Species Pres. Purity   Source  

Parkinson disease 7 domain containing 1 (PDDC1)

Parkinson disease 7 domain containing 1 (PDDC1) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Positive controls for PDDC1 (1 products)

Catalog No. Species Pres. Purity   Source  

PDDC1 overexpression lysate

PDDC1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn