TA343338 PDGFA antibody

Rabbit Polyclonal Anti-PDGFA Antibody

See related secondary antibodies

Search for all "PDGFA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rat PDGFA

Product Description for PDGFA

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rat PDGFA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PDGFA

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms PDGF A, PDGF alpha, PDGF subunit A, PDGF-1, PDGF-A, PDGF1, Platelet-derived growth factor A chain, Platelet-derived growth factor alpha, Platelet-derived growth factor subunit A
Presentation Purified
Reactivity Can, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P04085
Immunogen:
The immunogen for anti-PDGFA antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFA. Synthetic peptide located within the following region: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR.
GeneID:
5154
Application WB
Background The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. This gene product can exist either as a homodimer or as a heterodimer with the platelet-derived growth factor beta polypeptide, where the dimers are connected by disulfide bonds. Studies using knockout mice have shown cellular defects in oligodendrocytes, alveolar smooth muscle cells, and Leydig cells in the testis; knockout mice die either as embryos or shortly after birth. Two splice variants have been identified for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 1098% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PDGFA (30 products)

Catalog No. Species Pres. Purity   Source  

PDGFA (transcript variant 2)

PDGFA Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PDGFA (transcript variant 2)

PDGFA Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €230.00
  OriGene Technologies, Inc.

PDGFA

PDGFA Human Purified >95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

PDGFA

PDGFA Human Purified >95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

PDGFA

PDGFA Human Purified >95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
E. coli
  OriGene Technologies GmbH

PDGFA (PDGF-AA)

PDGFA Human > 97 % pure by SDS-PAGE and HPLC analyses E. coli
  OriGene Technologies GmbH

PDGFA (PDGF-AA)

PDGFA Human > 97 % pure by SDS-PAGE and HPLC analyses E. coli
  OriGene Technologies GmbH

PDGFA (PDGF-AB)

PDGFA Human Purified > 98 % by SDS-PAGE and HPLC analyses E. coli
  OriGene Technologies GmbH

PDGFA (PDGF-AB)

PDGFA Human Purified > 98 % by SDS-PAGE and HPLC analyses E. coli
  OriGene Technologies GmbH

PDGFA (PDGF-AA)

PDGFA Human Purified > 95 % pure by SDS-PAGE and visualised by silver stain. E. coli
5 µg / €180.00
  OriGene Technologies GmbH

PDGFA (PDGF-AA)

PDGFA Human Purified > 95 % pure by SDS-PAGE and visualised by silver stain. E. coli
2 µg / €150.00
  OriGene Technologies GmbH

PDGFA (PDGF-AA)

PDGFA Human Purified > 95 % pure by SDS-PAGE and visualised by silver stain. E. coli
20 µg / €280.00
  OriGene Technologies GmbH

PDGFA (PDGF-AB)

PDGFA Human Purified > 95 % > 95%, by SDS-PAGE and visualised by silver stain. E. coli
5 µg / €180.00
  OriGene Technologies GmbH

PDGFA (PDGF-AB)

PDGFA Human Purified > 95 % > 95%, by SDS-PAGE and visualised by silver stain. E. coli
2 µg / €150.00
  OriGene Technologies GmbH

PDGFA (PDGF-AB)

PDGFA Human Purified > 95 % > 95%, by SDS-PAGE and visualised by silver stain. E. coli
20 µg / €280.00
  OriGene Technologies GmbH

PDGFA

PDGFA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PDGFA

PDGFA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PDGFA

PDGFA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PDGFA

PDGFA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PDGFA

PDGFA Human
  Abnova Taiwan Corp.

PDGFA

PDGFA Human
  Abnova Taiwan Corp.

PDGFA

PDGFA Human
  Abnova Taiwan Corp.

PDGFA

 PDGF-A Structure and Sequence. Human Purified > 95 % E. coli
5 µg / €190.00
  Neuromics Antibodies

PDGFA

 PDGF-A Structure and Sequence. Human Purified > 95 % E. coli
20 µg / €290.00
  Neuromics Antibodies

PDGFA (PDGF-AA)

 PDGF-AA Structure and Sequence. Human Purified > 97 % E. coli
2 µg / €190.00
  Neuromics Antibodies

PDGFA (PDGF-AA)

 PDGF-AA Structure and Sequence. Human Purified > 97 % E. coli
10 µg / €290.00
  Neuromics Antibodies

PDGFA (PDGF-AB)

PDGFA Human Purified > 97 % E. coli
2 µg / €190.00
  Neuromics Antibodies

PDGFA (PDGF-AB)

PDGFA Human Purified > 97 % E. coli
10 µg / €290.00
  Neuromics Antibodies

PDGFA

PDGFA Human Purified
  Novus Biologicals Inc.

PDGFA

PDGFA Human Purified
  Novus Biologicals Inc.

Positive controls for PDGFA (4 products)

Catalog No. Species Pres. Purity   Source  

PDGFA 293T Cell Transient Overexpression Lysate(Denatured)

PDGFA 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PDGFA overexpression lysate

PDGFA overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PDGFA overexpression lysate

PDGFA overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PDGFA overexpression lysate

PDGFA overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn