discontinued

H00056034-B01 PDGFC antibody

See related secondary antibodies

Search for all "PDGFC"

50 µl / €370.00

Quick Overview

Mouse anti Human PDGFC

H00056034-B01

More Views

  • H00056034-B01

Product Description for PDGFC

Mouse anti Human PDGFC.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for PDGFC

Product Category Primary Antibodies
Quantity 50 µl
Synonyms MaxPab, SCDGF, platelet derived growth factor C
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
PDGFC (NP_057289.1, 1 a.a. ~ 345 a.a) full-length human protein.
AA Sequence:
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWR LVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPS EPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFV FGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKK YHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Remarks:
Gene Accession: NM_016205
Add. information Mouse polyclonal antibody raised against a full-length human PDGFC protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human

Accessory Products

  • LinkedIn