discontinued

H00064236-B01P PDLIM2 antibody

See related secondary antibodies

Search for all "PDLIM2"

Quick Overview

Mouse anti Human PDLIM2

H00064236-B01P

More Views

  • H00064236-B01P

Product Description for PDLIM2

Mouse anti Human PDLIM2.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for PDLIM2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms PDZ and LIM domain protein 2, PDZ-LIM protein mystique, PP6345
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96JY6
Immunogen:
PDLIM2 (NP_067643.2, 1 a.a. ~ 352 a.a) full-length human protein.
AA Sequence:
MALTVDVAGPAPWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIRQSPSPL RLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPPSSSSLTGEAAIS RSFQSLACSPGLPAADRLSYSGRPGSRQAGLGRAGDSAVLVLPPSPGPRSSRPSMDSEGGSLLLDEDSEVFKMLQE NREGRAAPRQSSSFRLLQEALEAEERGGTPAFLPSSLSPQSSLPASRALATPPKLHTCEKCSTSIANQAVRIQEGR YRHPGCYTCADCGLNLKMRGHFWVGDELYCEKHARQRYSAPATLSSRA
GeneID:
64236
Remarks:
Gene Accession: NM_021630.4
Add. information Mouse polyclonal antibody raised against a full-length human PDLIM2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 64236

Accessory Products

Proteins and/or Positive Controls

Proteins for PDLIM2 (4 products)

Catalog No. Species Pres. Purity   Source  

PDLIM2 (transcript variant 2)

PDLIM2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PDLIM2 (transcript variant 1)

PDLIM2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PDLIM2

PDLIM2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PDLIM2

PDLIM2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PDLIM2 (5 products)

Catalog No. Species Pres. Purity   Source  

PDLIM2 293T Cell Transient Overexpression Lysate(Denatured)

PDLIM2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PDLIM2 Lysate

Western Blot: PDLIM2 Lysate [NBL1-14254] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PDLIM2
  Novus Biologicals Inc.

PDLIM2 overexpression lysate

PDLIM2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PDLIM2 overexpression lysate

PDLIM2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PDLIM2 overexpression lysate

PDLIM2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn