H00653650-A01 PDPK2 antibody

See related secondary antibodies

Search for all "PDPK2"

50 µl / €290.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human PDPK2

H00653650-A01

Product Description for PDPK2

Mouse anti Human PDPK2.
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for PDPK2

Product Category Primary Antibodies
Quantity 50 µl
Synonyms -
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
PDPK2 (XP_496112, 253 a.a. ~ 348 a.a) partial recombinant protein with GST tag.
AA Sequence:
PPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTP PKLTAYLPAMSEDDEDCYGN
GeneID:
653650
Add. information Mouse polyclonal antibody raised against a partial recombinant PDPK2.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
50 % glycerol
Specificity
Specificity:
Antibody Reactive Against Recombinant Protein.

Accessory Products

  • LinkedIn