H00653650-M01 PDPK2 antibody

See related secondary antibodies

Search for all "PDPK2"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human PDPK2 1G3

H00653650-M01

Product Description for PDPK2

Mouse anti Human PDPK2 1G3.
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for PDPK2

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms -
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 1G3
Host Mouse
Isotype IgG1
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
PDPK2 (XP_496112, 253 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
PPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTP PKLTAYLPAMSEDDEDCYGN
GeneID:
653650
Add. information Mouse monoclonal antibody raised against a partial recombinant PDPK2.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody Reactive Against Recombinant Protein.

Accessory Products

  • LinkedIn