NBP1-54925 PDZRN4 antibody

See related secondary antibodies

Search for all "PDZRN4"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PDZRN4

Product Description for PDZRN4

Rabbit anti Human PDZRN4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PDZRN4

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B4DG65
Immunogen:
Synthetic peptides corresponding to PDZRN4(PDZ domain containing ring finger 4) The peptide sequence was selected from the N terminal of PDZRN4. Peptide sequence SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL.
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn