discontinued

NBP1-54925 PDZRN4 antibody

See related secondary antibodies

Search for all "PDZRN4"

Quick Overview

Rabbit anti Human PDZRN4

Product Description for PDZRN4

Rabbit anti Human PDZRN4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PDZRN4

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B4DG65
Immunogen:
Synthetic peptides corresponding to PDZRN4(PDZ domain containing ring finger 4) The peptide sequence was selected from the N terminal of PDZRN4. Peptide sequence SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL.
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn