
NBP1-54365 PECI antibody

See related secondary antibodies

Search for all "PECI"

Quick Overview

Rabbit anti Human, Rat PECI

Product Description for PECI

Rabbit anti Human, Rat PECI.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PECI

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ACBD2, DRS1, HCA88, dJ1013A10.3
Presentation Aff - Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PECI(peroxisomal D3,D2-enoyl-CoA isomerase) The peptide sequence was selected from the middle region of PECI. Peptide sequence AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK.
Background PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-40 AU100345.1 1-40 41-1380 BC033841.1 11-1350 1381-1410 BQ653836.1 596-625
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 10455

Accessory Products

  • LinkedIn