NBP1-59580 PEMT antibody

See related secondary antibodies

Search for all "PEMT"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PEMT

Product Description for PEMT

Rabbit anti Human PEMT.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PEMT

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC2483, PEAMT, PEMPT, PEMT2, PNMT
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BW86
Immunogen:
Synthetic peptides corresponding to PEMT(phosphatidylethanolamine N-methyltransferase) The peptide sequence was selected from the C terminal of PEMT. Peptide sequence GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS.
GeneID:
10400
Background PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene is within the Smith-Magenis syndrome region on chromosome 17. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 10400

Accessory Products

  • LinkedIn