TA330521 Peroxin 10 / PEX10 / RNF69 antibody

Rabbit Polyclonal Anti-PEX10 Antibody

See related secondary antibodies

Search for all "Peroxin 10 / PEX10 / RNF69"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Peroxin 10 / PEX10 / RNF69


More Views

  • TA330521

Product Description for Peroxin 10 / PEX10 / RNF69

Rabbit anti Human Peroxin 10 / PEX10 / RNF69.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Peroxin 10 / PEX10 / RNF69

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Peroxin-10, Peroxisomal biogenesis factor 10, Peroxisome assembly protein 10, Peroxisome biogenesis factor 10, RING finger protein 69
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-PEX10 antibody: synthetic peptide directed towards the middle region of human PEX10. Synthetic peptide located within the following region: QALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVL.
Application WB
Background PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neotal adrenoleukodystrophy to Zellweger syndrome.This gene encodes a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neotal adrenoleukodystrophy to Zellweger syndrome. Altertive splicing results in two transcript variants encoding different isoforms.
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Peroxin 10 / PEX10 / RNF69 (2 products)

Catalog No. Species Pres. Purity   Source  

Peroxin 10 / PEX10 / RNF69

Peroxin 10 / PEX10 / RNF69 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Peroxin 10 / PEX10 / RNF69

Peroxin 10 / PEX10 / RNF69 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Peroxin 10 / PEX10 / RNF69 (1 products)

Catalog No. Species Pres. Purity   Source  

PEX10 Lysate

Western Blot: PEX10 Lysate [NBL1-14292] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PEX10.
  Novus Biologicals Inc.
  • LinkedIn