
NBP1-58348 Peroxiredoxin 5 antibody

See related secondary antibodies

Search for all "Peroxiredoxin 5"

50 µg / €440.00

Quick Overview

Rabbit anti Human Peroxiredoxin 5

Product Description for Peroxiredoxin 5

Rabbit anti Human Peroxiredoxin 5.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Peroxiredoxin 5

Product Category Primary Antibodies
Quantity 50 µg
Synonyms ACR1, AOEB166, B166, MGC117264, MGC142283, MGC142285, PLP, PMP20, PRDX6, PRXV, SBBI10
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PRDX5(peroxiredoxin 5) The peptide sequence was selected from the middle region of PRDX5. Peptide sequence TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI.
Background PRDX5 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms.This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 25824

Accessory Products

  • LinkedIn