discontinued

H00005202-B01 PFDN2 antibody

See related secondary antibodies

Search for all "PFDN2"

Quick Overview

Mouse anti Human PFDN2

Product Description for PFDN2

Mouse anti Human PFDN2.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for PFDN2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms HSPC231, PFD2, Prefoldin subunit 2
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UHV9
Immunogen:
PFDN2 (NP_036526, 1 a.a. ~ 154 a.a) full-length human protein.
AA Sequence:
MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGG VLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVL VS
GeneID:
5202
Remarks:
Gene Accession: NM_012394
Add. information Mouse polyclonal antibody raised against a full-length human PFDN2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 5202

Accessory Products

Proteins and/or Positive Controls

Proteins for PFDN2 (7 products)

Catalog No. Species Pres. Purity   Source  

PFDN2

PFDN2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

PFDN2

PFDN2 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €399.00
  OriGene Technologies, Inc.

PFDN2 (1-154, His-tag)

PFDN2 Human Purified > 90 % E. coli
0.25 mg / €750.00
  OriGene Technologies GmbH

PFDN2 (1-154, His-tag)

PFDN2 Human Purified > 90 % E. coli
50 µg / €300.00
  OriGene Technologies GmbH

PFDN2

PFDN2 Human in vitro transl.
  Abnova Taiwan Corp.

PFDN2

PFDN2 Human Purified
  Novus Biologicals Inc.

PFDN2

PFDN2 Human Purified
  Novus Biologicals Inc.

Positive controls for PFDN2 (2 products)

Catalog No. Species Pres. Purity   Source  

PFDN2 293T Cell Transient Overexpression Lysate(Denatured)

PFDN2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PFDN2 Lysate

Western Blot: PFDN2 Lysate [NBL1-14307] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PFDN2.
  Novus Biologicals Inc.
  • LinkedIn