
NBP1-56607 PFKL antibody

See related secondary antibodies

Search for all "PFKL"

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat PFKL

Product Description for PFKL

Rabbit anti Canine, Human, Mouse, Rat PFKL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PFKL

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms DKFZp686G1648, DKFZp686L2097, FLJ30173, FLJ40909, PFK-B
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PFKL(phosphofructokinase, liver) The peptide sequence was selected from the middle region of PFKL. Peptide sequence RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA.
Background Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 5211

Accessory Products

  • LinkedIn