
NBP1-56607 PFKL antibody

See related secondary antibodies

Search for all "PFKL"

0.1 mg / €360.00

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat PFKL

Product Description for PFKL

Rabbit anti Canine, Human, Mouse, Rat PFKL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PFKL

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms DKFZp686G1648, DKFZp686L2097, FLJ30173, FLJ40909, PFK-B
Presentation Purified
Reactivity Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PFKL(phosphofructokinase, liver) The peptide sequence was selected from the middle region of PFKL. Peptide sequence RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA.
Background Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.
Gene ID 5211

Accessory Products

  • LinkedIn