TA346623 PGCP antibody

Rabbit Polyclonal Anti-PGCP Antibody

See related secondary antibodies

Search for all "PGCP"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PGCP

Product Description for PGCP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PGCP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PGCP

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Plasma glutamate carboxypeptidase
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y646
Immunogen:
The immunogen for anti-PGCP antibody: synthetic peptide directed towards the N terminal of human PGCP. Synthetic peptide located within the following region: VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA.
GeneID:
10404
Application WB
Background This gene encodes a metallopeptidase that belongs to the peptidase M28 family. The encoded protein may catalyze the cleavage of dipeptides with unsubstituted terminals into amino acids. [provided by RefSeq, Jul 2013].
Format
Purification:
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PGCP (2 products)

Catalog No. Species Pres. Purity   Source  

PGCP

PGCP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PGCP

PGCP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PGCP (2 products)

Catalog No. Species Pres. Purity   Source  

PGCP 293T Cell Transient Overexpression Lysate(Denatured)

PGCP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PGCP Lysate

Western Blot: PGCP Lysate [NBL1-14328] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PGCP.
  Novus Biologicals Inc.
  • LinkedIn