discontinued

NBP1-56771 PGR1 antibody

See related secondary antibodies

Search for all "PGR1"

50 µg / €390.00

Quick Overview

Rabbit anti Human PGR1

Product Description for PGR1

Rabbit anti Human PGR1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PGR1

Product Category Primary Antibodies
Quantity 50 µg
Synonyms MGC34943
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8K0N2
Immunogen:
Synthetic peptides corresponding to LTB4DH The peptide sequence was selected from the N terminal of LTB4DH. Peptide sequence VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR.
GeneID:
22949
Background LTB4DH functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. LTB4DH catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 22949

Accessory Products

  • LinkedIn