
TA343437 Phox2b antibody

Rabbit Polyclonal Anti-Phox2b Antibody

See related secondary antibodies

Search for all "Phox2b"

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Phox2b


Product Description for Phox2b

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Phox2b.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Phox2b

Product Category Primary Antibodies
Quantity 50 µg
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-Phox2b antibody is: synthetic peptide directed towards the N-terminal region of Rat Phox2b. Synthetic peptide located within the following region: MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTT.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn