NBP1-93967 PID1 antibody

See related secondary antibodies

Search for all "PID1"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PID1

NBP1-93967

More Views

  • NBP1-93967
  • NBP1-93967

Product Description for PID1

Rabbit anti Human PID1.
Presentation: Aff - Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for PID1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z2X4
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG
GeneID:
55022
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 55022

Accessory Products

Proteins and/or Positive Controls

Proteins for PID1 (2 products)

Catalog No. Species Pres. Purity   Source  

Phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1 (transcript variant 1)

Phosphotyrosine interaction domain containing 1 (PID1), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

Phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2 (transcript variant 2)

Phosphotyrosine interaction domain containing 1 (PID1), transcript variant 2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for PID1 (2 products)

Catalog No. Species Pres. Purity   Source  

PID1 overexpression lysate

PID1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

PID1 overexpression lysate

PID1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn