NBP1-90968 PIRT antibody

See related secondary antibodies

Search for all "PIRT"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PIRT

Product Description for PIRT

Rabbit anti Human PIRT.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for PIRT

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: ETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYR
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
Aff - Purified
Gene ID 644139

Accessory Products

Proteins and/or Positive Controls

Positive controls for PIRT (1 products)

Catalog No. Species Pres. Purity   Source  

PIRT overexpression lysate

PIRT overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn