
NBP1-74104 PKD2L1 antibody

See related secondary antibodies

Search for all "PKD2L1"

Quick Overview

Rabbit anti Rat PKD2L1


Product Description for PKD2L1

Rabbit anti Rat PKD2L1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PKD2L1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the N terminal of Pkd2l1. Immunizing peptide sequence LWGTTLTENTAENRELYVKTTLRELVVYIVFLVDVCLLTYGMTSSSAYYY.
Background The function of this protein remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Reconstitute with 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 2939373

Accessory Products

  • LinkedIn