
NBP1-74255 PKI-beta antibody

See related secondary antibodies

Search for all "PKI-beta"

Quick Overview

Rabbit anti Rat PKI-beta


Product Description for PKI-beta

Rabbit anti Rat PKI-beta.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PKI-beta

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the middle region of Pkib. Immunizing peptide sequence TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA.
Background Pkib displays strong inhibition of the activity of cAMP-dependent protein kinase.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified
Gene ID 24678

Accessory Products

  • LinkedIn