NBP1-90721 PLAC8 antibody

See related secondary antibodies

Search for all "PLAC8"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PLAC8

NBP1-90721

More Views

  • NBP1-90721

Product Description for PLAC8

Rabbit anti Human PLAC8.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for PLAC8

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZF1
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF
GeneID:
51316
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 51316

Accessory Products

Proteins and/or Positive Controls

Proteins for PLAC8 (4 products)

Catalog No. Species Pres. Purity   Source  

PLAC8 (1-115, His-tag)

PLAC8 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

PLAC8 (1-115, His-tag)

PLAC8 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

Placenta-specific 8 (PLAC8), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag, transcript variant 2)

Placenta-specific 8 (PLAC8), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Placenta-specific 8 (PLAC8), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug (full length, N-term HIS tag, transcript variant 3)

Placenta-specific 8 (PLAC8), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.
  • LinkedIn