NBP1-57943 Plasminogen antibody

See related secondary antibodies

Search for all "Plasminogen"

50 µg / €390.00

Quick Overview

Rabbit anti Human Plasminogen

Product Description for Plasminogen

Rabbit anti Human Plasminogen.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Plasminogen

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp779M0222
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to PLG(plasminogen) The peptide sequence was selected from the middle region of PLG. Peptide sequence LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE.
Background The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin. Plasmin dissolves fibrin in blood clots and is an important protease in many other cellular processes while angiostatin
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 100172984

Accessory Products

  • LinkedIn