H00059339-B01P PLEKHA2 antibody

See related secondary antibodies

Search for all "PLEKHA2"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human PLEKHA2

H00059339-B01P

Product Description for PLEKHA2

Mouse anti Human PLEKHA2.
Product is tested for Western blot / Immunoblot.

Properties for PLEKHA2

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ25921, TAPP2
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HB19
Immunogen:
PLEKHA2 (AAI66639.1, 1 a.a. ~ 425 a.a) full-length human protein.
AA Sequence:
MPYVDRQNRICGFLDIEEHENSGKFLRRYFILDTQANCLLWYMDNPQNLAMGAGAVGALQLTYISKVSIATPKQKP KTPFCFVINALSQRYFLQANDQKDMKDWVEALNQASKITVPKGGGLPMTTEVLKSLAAPPALEKKPQVAYKTEIIG GVVVHTPISQNGGDGQEGSEPGSHTILRRSQSYIPTSGCRASTGPPLIKSGYCVKQGNVRKSWKRRFFALDDFTIC YFKCEQDREPLRTIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYVQADSPEDMHSWIKEIGAAVQALKCHP RETSFSRSISLTRPGSSSLSSGPNSILCRGRPPLEEKKALCKAPSVASSWQPWTPVPQAGEKLLPPGDTSEDSLFT PRPGEGSAPGVLPSSRIRHRSEPQHPKEKPFMFNLDDENIRTSDV
GeneID:
59339
Add. information Mouse polyclonal antibody raised against a full-length human PLEKHA2 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for PLEKHA2 (1 products)

Catalog No. Species Pres. Purity   Source  

Pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 2 (PLEKHA2)

Pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 2 (PLEKHA2) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.
  • LinkedIn