discontinued

NBP1-57947 Plexin A4 antibody

See related secondary antibodies

Search for all "Plexin A4"

50 µg / €440.00

Quick Overview

Rabbit anti Human Plexin A4

Product Description for Plexin A4

Rabbit anti Human Plexin A4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Plexin A4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp434G0625, DKFZp566O0546, FAYV2820, FLJ35026, FLJ38287, KIAA1550, PLEXA4, PLXNA4A, PLXNA4B, PRO34003
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4D1N6
Immunogen:
Synthetic peptides corresponding to PLXNA4(plexin A4) The peptide sequence was selected from the middle region of PLXNA4. Peptide sequence TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV.
GeneID:
91584
Background This protein mediates semaphorin receptor activity.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 91584

Accessory Products

  • LinkedIn