NBP1-57947 Plexin A4 antibody

See related secondary antibodies

Search for all "Plexin A4"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Plexin A4

Product Description for Plexin A4

Rabbit anti Human Plexin A4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Plexin A4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms DKFZp434G0625, DKFZp566O0546, FAYV2820, FLJ35026, FLJ38287, KIAA1550, PLEXA4, PLXNA4A, PLXNA4B, PRO34003
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4D1N6
Immunogen:
Synthetic peptides corresponding to PLXNA4(plexin A4) The peptide sequence was selected from the middle region of PLXNA4. Peptide sequence TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV.
GeneID:
91584
Background This protein mediates semaphorin receptor activity.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 91584

Accessory Products

  • LinkedIn