discontinued

H00005373-M01 PMM2 antibody

See related secondary antibodies

Search for all "PMM2"

Quick Overview

Mouse anti Human PMM2 2E9

Product Description for PMM2

Mouse anti Human PMM2 2E9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for PMM2

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms PMM 2, Phosphomannomutase 2
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2E9
Host Mouse
Isotype IgG2b
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O15305
Immunogen:
PMM2 (NP_000294, 47 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
SDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIK*
GeneID:
5373
Remarks:
Gene Accession: NM_000303
Isotype control AM03110PU-N, SM12P
Add. information Mouse monoclonal antibody raised against a partial recombinant PMM2.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 5373

Accessory Products

Proteins and/or Positive Controls

Proteins for PMM2 (11 products)

Catalog No. Species Pres. Purity   Source  

PMM2

PMM2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

PMM2

PMM2 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €399.00
  OriGene Technologies, Inc.

PMM2 (1-246, His-tag)

PMM2 Human Purified > 95 % by SDS – PAGE E. coli
0.5 mg / €750.00
  OriGene Technologies GmbH

PMM2 (1-246, His-tag)

PMM2 Human Purified > 95 % by SDS – PAGE E. coli
0.1 mg / €300.00
  OriGene Technologies GmbH

PMM2

PMM2 Human in vitro transl.
  Abnova Taiwan Corp.

PMM2

PMM2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PMM2

PMM2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PMM2

PMM2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PMM2

PMM2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PMM2

PMM2 Human Purified
  Novus Biologicals Inc.

PMM2

PMM2 Human Purified
  Novus Biologicals Inc.

Positive controls for PMM2 (1 products)

Catalog No. Species Pres. Purity   Source  

PMM2 293T Cell Transient Overexpression Lysate(Denatured)

PMM2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn