TA335592 PNKD antibody

Rabbit Polyclonal Anti-Pnkd Antibody

See related secondary antibodies

Search for all "PNKD"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Goat, Human, Rabbit, Rat PNKD

Product Description for PNKD

Rabbit anti Bovine, Canine, Equine, Goat, Human, Rabbit, Rat PNKD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PNKD

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms FKSG19, KIAA1184, MR-1, MR1, Myofibrillogenesis regulator 1, Paroxysmal nonkinesiogenic dyskinesia protein, Probable hydrolase PNKD, TAHCCP2, Trans-activated by hepatitis C virus core protein 2, UNQ2491/PRO5778
Presentation Purified
Reactivity Bov, Can, Eq, Gt, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N490
Immunogen:
The immunogen for Anti-Pnkd Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHSSPECK.
GeneID:
25953
Application WB
Background Pnkd is a probable hydrolase that plays an aggravative role in the development of cardiac hypertrophy via activation of the NF-kappa-B sigling pathway.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PNKD (3 products)

Catalog No. Species Pres. Purity   Source  

PNKD (transcript variant 1)

PNKD Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

PNKD

PNKD Human Purified
  Abnova Taiwan Corp.

PNKD

PNKD Human Purified
  Abnova Taiwan Corp.

Positive controls for PNKD (4 products)

Catalog No. Species Pres. Purity   Source  

PNKD 293T Cell Transient Overexpression Lysate(Denatured)

PNKD 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PNKD Lysate

Western Blot: PNKD Lysate [NBL1-14542] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PNKD
  Novus Biologicals Inc.

PNKD overexpression lysate

PNKD overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PNKD overexpression lysate

PNKD overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn